Structure of PDB 7vo0 Chain N

Receptor sequence
>7vo0N (length=131) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence]
PPVKGRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTL
QSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVE
KWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
3D structure
PDB7vo0 Structural basis of Streptomyces transcription activation by zinc uptake regulator.
ChainN
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna N R11 Q15 T50 R53 R6 Q10 T45 R48
BS02 dna N R11 T49 Y52 E73 S74 R6 T44 Y47 E68 S69
BS03 ZN N D65 C79 H85 H87 D60 C74 H80 H82
BS04 ZN N H84 H86 E105 H122 H79 H81 E100 H117
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vo0, PDBe:7vo0, PDBj:7vo0
PDBsum7vo0
PubMed35871291
UniProtQ9L2H5

[Back to BioLiP]