Structure of PDB 7uvx Chain N

Receptor sequence
>7uvxN (length=115) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
NEKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLAQ
ASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGR
IKALADAAREGGLEF
3D structure
PDB7uvx Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainN
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R10 R11 S14 L17 H18 R93 Y98 F116 R9 R10 S13 L16 H17 R92 Y97 F115
BS02 rna N K4 K5 R16 R20 R26 R31 T32 R34 H35 Y37 Q39 G45 G46 V48 Q51 R60 N66 I67 H99 R101 K3 K4 R15 R19 R25 R30 T31 R33 H34 Y36 Q38 G44 G45 V47 Q50 R59 N65 I66 H98 R100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvx, PDBe:7uvx, PDBj:7uvx
PDBsum7uvx
PubMed37192172
UniProtB7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]