Structure of PDB 7uvw Chain N

Receptor sequence
>7uvwN (length=116) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MNEKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLA
QASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHG
RIKALADAAREGGLEF
3D structure
PDB7uvw Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainN
Resolution2.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R11 S14 L17 H18 R93 Y98 R110 F116 R11 S14 L17 H18 R93 Y98 R110 F116
BS02 rna N M1 N2 K5 R16 R20 R26 R31 T32 R34 H35 Y37 G45 Q51 R60 N66 I67 H99 G100 R101 M1 N2 K5 R16 R20 R26 R31 T32 R34 H35 Y37 G45 Q51 R60 N66 I67 H99 G100 R101
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvw, PDBe:7uvw, PDBj:7uvw
PDBsum7uvw
PubMed37192172
UniProtB7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]