Structure of PDB 7uqz Chain N

Receptor sequence

>7uqzN (length=189) Species: 1247190 (Saccharomyces cerevisiae BY4741)

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPELKYQRSLRATAEERVGRRAANLRV
LNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWICDPVHKHREARGLT
ATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWRYRK

3D structure

• PDB: 7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
• Chain: N
• Resolution: 2.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	G2 Y4 K5 E8 R12 K14 R20 R24 R31 N34 V35 R41 R44 K47 R49 R50 L51 A55 K56 Q57 R67 R68 G69 N70 R71 K72 R73 P76 E91 K93 Y94 Q95 R96 S97 R105 R108 N112 N117 W120 S125 Y127 K128 Q138 K140 A141 R144 R147 W150 P154 V155 H156 K157 H158 A161 R162 A166 K169 K170 S171 R172 I174 K176 G177 H178 K179 R187 R188 K189 W191 K192 R193 W200 R201 Y202 R203 K204	G1 Y3 K4 E7 R11 K13 R19 R23 R30 N33 V34 R40 R43 K46 R48 R49 L50 A54 K55 Q56 R66 R67 G68 N69 R70 K71 R72 P75 E76 K78 Y79 Q80 R81 S82 R90 R93 N97 N102 W105 S110 Y112 K113 Q123 K125 A126 R129 R132 W135 P139 V140 H141 K142 H143 A146 R147 A151 K154 K155 S156 R157 I159 K161 G162 H163 K164 R172 R173 K174 W176 K177 R178 W185 R186 Y187 R188 K189
BS02	rna	N	R38 Q57 Y62 R109 N112 D136 H139	R37 Q56 Y61 R94 N97 D121 H124

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
• PDBsum: 7uqz
• PubMed: 36864048
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)