Structure of PDB 7unr Chain N

Receptor sequence

>7unrN (length=144) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]

MQLNDLRSAPGARREKHRPGRGIGSGLGKTGGRGHKGLTSRSGGKVAPGF
EGGQQPLHRRLPKFGFVSLKAMDRAEVRTSELAKVEGDVVSLQTLKDANL
INQHVQRVKVMLSGEVGRAVTLKGIAATKGARAAIEAAGGKFED

3D structure

PDB

7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	L3 N4 R7 G11 A12 R13 R14 K16 H17 R18 P19 G20 R21 G22 G24 S25 G28 K29 T30 G32 R33 G34 K36 G37 L38 T39 R41 S42 G43 F50 G52 G53 Q54 Q55 R59 R60 P62 K63 F64 G65 F66 V67 S68 E76 R78 E81 K84 N99 Q103 K109 M111 L112 T128 K129	L3 N4 R7 G11 A12 R13 R14 K16 H17 R18 P19 G20 R21 G22 G24 S25 G28 K29 T30 G32 R33 G34 K36 G37 L38 T39 R41 S42 G43 F50 G52 G53 Q54 Q55 R59 R60 P62 K63 F64 G65 F66 V67 S68 E76 R78 E81 K84 N99 Q103 K109 M111 L112 T128 K129
BS02	MG	N	G34 H35	G34 H35

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum	7unr
PubMed
UniProt	Q9HWF4\|RL15_PSEAE Large ribosomal subunit protein uL15 (Gene Name=rplO)