Structure of PDB 7tut Chain N

Receptor sequence

>7tutN (length=202) Species: 9986 (Oryctolagus cuniculus)

GYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLG
YKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVA
EERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWIT
KPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHR
YR

3D structure

• PDB: 7tut Mechanism of an intramembrane chaperone for multipass membrane proteins.
• Chain: N
• Resolution: 3.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	R38 Q57 Y62 D136 H139	R36 Q55 Y60 D134 H137
BS02	rna	N	Y4 R12 K14 Q15 R24 W28 R31 Q32 P40 R41 R44 K47 R49 R50 K54 A55 K56 R65 R67 R68 G69 G70 R71 K72 R73 K77 Y81 G82 K83 P84 V85 H86 H87 N90 Q91 K93 F94 A95 R96 E104 R105 R108 A112 N117 S125 Y127 F138 K140 R144 W150 P154 V155 H156 K157 H158 M161 R162 L164 S166 K170 R172 K176 G177 H178 K179 H181 H182 G185 G186 S187 R189 W192 R193 R194 R195 Q199 H201 R202 R204	Y2 R10 K12 Q13 R22 W26 R29 Q30 P38 R39 R42 K45 R47 R48 K52 A53 K54 R63 R65 R66 G67 G68 R69 K70 R71 K75 Y79 G80 K81 P82 V83 H84 H85 N88 Q89 K91 F92 A93 R94 E102 R103 R106 A110 N115 S123 Y125 F136 K138 R142 W148 P152 V153 H154 K155 H156 M159 R160 L162 S164 K168 R170 K174 G175 H176 K177 H179 H180 G183 G184 S185 R187 W190 R191 R192 R193 Q197 H199 R200 R202

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7tut, PDBe:7tut, PDBj:7tut
• PDBsum: 7tut
• PubMed: 36261528
• UniProt: G1T0C1|RL15_RABIT Large ribosomal subunit protein eL15 (Gene Name=RPL15)