Structure of PDB 7syw Chain N

Receptor sequence
>7sywN (length=117) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVK
LVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD
YGKESQAKDVIEEYFKC
3D structure
PDB7syw Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
ChainN
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R33 I35 R36 E58 L91 R101 V104 G105 C106 S107 R20 I22 R23 E45 L78 R88 V91 G92 C93 S94
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0090263 positive regulation of canonical Wnt signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7syw, PDBe:7syw, PDBj:7syw
PDBsum7syw
PubMed35822879
UniProtG1SFR8|RS12_RABIT Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]