Structure of PDB 7syt Chain N

Receptor sequence
>7sytN (length=117) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVK
LVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD
YGKESQAKDVIEEYFKC
3D structure
PDB7syt Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
ChainN
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R33 I35 E37 D57 L91 R101 G105 C106 S107 R20 I22 E24 D44 L78 R88 G92 C93 S94
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0090263 positive regulation of canonical Wnt signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7syt, PDBe:7syt, PDBj:7syt
PDBsum7syt
PubMed35822879
UniProtG1SFR8|RS12_RABIT Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]