Structure of PDB 7r6q Chain N

Receptor sequence

>7r6qN (length=131) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRRSLRATAEERVGRRAANLRVLNSYWVNQ
DSTYKYFEVILVDPQHKAIRRDARYNWICDP

3D structure

PDB

7r6q Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

Chain

Resolution

2.98 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	Y4 K5 R12 K14 Q15 N34 V35 R41 R44 K47 R49 R50 K54 A55 K56 Q57 R67 R96 R105 R108 N112 W120 Q138 K140 R144 R147 W150	Y3 K4 R11 K13 Q14 N33 V34 R40 R43 K46 R48 R49 K53 A54 K55 Q56 R66 R73 R82 R85 N89 W97 Q115 K117 R121 R124 W127
BS02	rna	N	R38 Q57 Y62 R109 N112 D136 H139	R37 Q56 Y61 R86 N89 D113 H116

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7r6q, PDBe:7r6q, PDBj:7r6q
PDBsum	7r6q
PubMed	36482249
UniProt	P05748\|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)