Structure of PDB 7r6k Chain N

Receptor sequence
>7r6kN (length=92) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
EELQRKKQSDVLRFLQRVRVWEYRQKNVIHRVRVRRGNRKRPVNELKYQR
SLRATAEERVGRSYWVNQDSTYKYFEVREARGLTATGKKSRG
3D structure
PDB7r6k Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
ChainN
Resolution3.17 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R12 K14 Q15 N34 V35 R67 R68 G69 N70 K93 Q95 R96 S97 L98 R105 R108 A161 R162 K170 S171 R172 R5 K7 Q8 N27 V28 R35 R36 G37 N38 K47 Q49 R50 S51 L52 R59 R62 A80 R81 K89 S90 R91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6k, PDBe:7r6k, PDBj:7r6k
PDBsum7r6k
PubMed36482249
UniProtP05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)

[Back to BioLiP]