Structure of PDB 7qiz Chain N

Receptor sequence

>7qizN (length=204) Species: 4081 (Solanum lycopersicum) [Search protein sequence]

MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTA
GSLRPIVHGQTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRR
RNRSLEGLQTNVQRLKTYKAKLVIFPRRAKKVKAGDSSAEELANATQVQG
PYLPIVRDQPAIELVKITDEMKSFKAYGKLRIERTNARHFGARLKRAAEA
EKEE

3D structure

PDB

7qiz Specific features and methylation sites of a plant ribosome

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	M1 K2 H3 V6 P8 N9 H11 F12 K13 K14 H15 W16 Q17 R21 W23 F24 Q26 P27 R29 K30 R33 R34 R37 K40 R54 V57 H58 G59 Q60 T61 Y64 N65 M66 K67 R69 G71 R72 L76 P85 K86 K87 D97 H98 R99 R100 R101 R103 S104 R127 R128 K133 A134 R157 Y177 R181 R184 T185 R188 H189 R193 K195	M1 K2 H3 V6 P8 N9 H11 F12 K13 K14 H15 W16 Q17 R21 W23 F24 Q26 P27 R29 K30 R33 R34 R37 K40 R54 V57 H58 G59 Q60 T61 Y64 N65 M66 K67 R69 G71 R72 L76 P85 K86 K87 D97 H98 R99 R100 R101 R103 S104 R127 R128 K133 A134 R157 Y177 R181 R184 T185 R188 H189 R193 K195
BS02	rna	N	F24 N25 A28 R32	F24 N25 A28 R32

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
PDBsum	7qiz
PubMed	35643637
UniProt	A0A3Q7JCM5

[Back to BioLiP]