Structure of PDB 7qiy Chain N

Receptor sequence
>7qiyN (length=50) Species: 4081 (Solanum lycopersicum) [Search protein sequence]
WNAHPKNYGPGSRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR
3D structure
PDB7qiy Cryo-EM structure and rRNA modification sites of a plant ribosome.
ChainN
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N W7 N8 H10 Y14 G15 P16 G17 R19 C24 N26 H28 A29 I30 R32 K33 Y34 R40 Q41 R44 K54 Y55 R56 W1 N2 H4 Y8 G9 P10 G11 R13 C18 N20 H22 A23 I24 R26 K27 Y28 R34 Q35 R38 K48 Y49 R50
BS02 ZN N C21 C24 C39 C42 C15 C18 C33 C36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qiy, PDBe:7qiy, PDBj:7qiy
PDBsum7qiy
PubMed35643637
UniProtA0A3Q7ITW7

[Back to BioLiP]