Structure of PDB 7qix Chain N

Receptor sequence

>7qixN (length=98) Species: 4081 (Solanum lycopersicum) [Search protein sequence]

TFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVR
DVQEACAFELYTLPKLYLKMQYCVSCAIHSKVVRVRSRTDRRVREPPQ

3D structure

PDB

7qix Cryo-EM structure and rRNA modification sites of a plant ribosome.

Chain

Resolution

2.53 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	T2 F3 K4 R5 R6 N7 G8 G9 R10 N11 H13 G14 R15 G16 H17 K19 F20 K28 K32 K34 K37 R38 F39 K70 V75 S76 I79 H80 V86 R87 R89 R92 R93 R95	T1 F2 K3 R4 R5 N6 G7 G8 R9 N10 H12 G13 R14 G15 H16 K18 F19 K27 K31 K33 K36 R37 F38 K69 V74 S75 I78 H79 V85 R86 R88 R91 R92 R94
BS02	ZN	N	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links