Structure of PDB 7qhm Chain N

Receptor sequence

>7qhmN (length=401) Species: 196627 (Corynebacterium glutamicum ATCC 13032)

QYTTQELNAMSNEDLARLGTELDDVTIAYRKERFPIANDPAEKRAARAVT
FWLVLGIIGGLGFLATYIFWPWEYKAHGDEGLLAYTLYTPMLGITSGLCI
LSLGFAVVLYVKKFIPEEIAVQRRHDGPSEEVDRRTIVALLNDSWQTSTL
GRRKLIMGLAGGGAVLAGLTIIAPMGGMIKNPWNPKEGPMDVQGDGTLWT
SGWTLVENDVKVYLGRDTAAIAESHTDATGEHWSTTGVSRLVRMRPEDLA
AASMETVFPLPAEMVNDGAEYDPAKDVYEHQMHSVHGPRNAVMLIRLRTA
DAEKVIEREGQESFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQS
QFDALHYGKPVFGPAARALPQLPITVDEEGYLIAAGNFIEPLGPAFWERK
S

3D structure

• PDB: 7qhm Structural basis for safe and efficient energy conversion in a respiratory supercomplex.
• Chain: N
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	N	A309 E310 E314 R315 E316 E319 Y323 Y364 A375	A302 E303 E307 R308 E309 E312 Y316 Y357 A368
BS02	MQ9	N	S103 I107	S96 I100
BS03	MQ9	N	T177 I178 M182	T170 I171 M175
BS04	FES	N	C333 H335 I336 C338 C352 H355 S357	C326 H328 I329 C331 C345 H348 S350
BS05	IZL	N	W190 W206 W404 E405	W183 W199 W397 E398
BS06	9YF	N	G183 G184 I186 K187 N188 N191	G176 G177 I179 K180 N181 N184
BS07	SMA	N	C354 H355	C347 H348

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:7qhm, PDBe:7qhm, PDBj:7qhm
• PDBsum: 7qhm
• PubMed: 35087070
• UniProt: Q79VE8|QCRA_CORGL Cytochrome bc1 complex Rieske iron-sulfur subunit (Gene Name=qcrA)