Structure of PDB 7q0f Chain N

Receptor sequence
>7q0fN (length=116) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
IEDALKVVLRTSLVHDGLARGLREASKALSKREAQLCVLCDSVTEESIIK
LVEALCNEPEEKIPLIKVSDAKLLGEWAGLCQLDRDGNARKVVGASCVVV
KNWGADSDERNILLEH
3D structure
PDB7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
ChainN
Resolution2.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R43 G44 L45 R46 E47 K50 V66 L103 K114 V116 G117 A118 S119 R20 G21 L22 R23 E24 K27 V43 L80 K91 V93 G94 A95 S96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum7q0f
PubMed35613268
UniProtQ5ADQ6|RS12_CANAL Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]