Structure of PDB 7pnt Chain N

Receptor sequence
>7pntN (length=113) Species: 10090 (Mus musculus) [Search protein sequence]
IVRSSVHAKWVVGKVIGTAMIKTAKVRATRLVLDPYLLKYFNKRKTYFAH
DALQQCSVGDIVLLRALPVPRSKHVKHELAEIIFKVGRVIDPVTGKPCAG
TAYLESPLSEPRE
3D structure
PDB7pnt Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainN
Resolution3.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N S7 H9 A10 M22 I23 T25 K27 R32 V34 Y38 N44 K45 R46 K47 Y49 F50 R73 S74 K75 H76 V77 K78 S5 H7 A8 M20 I21 T23 K25 R30 V32 Y36 N42 K43 R44 K45 Y47 F48 R71 S72 K73 H74 V75 K76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnt, PDBe:7pnt, PDBj:7pnt
PDBsum7pnt
PubMed35676484
UniProtQ9CQE3|RT17_MOUSE Small ribosomal subunit protein uS17m (Gene Name=Mrps17)

[Back to BioLiP]