Structure of PDB 7pd3 Chain N

Receptor sequence
>7pd3N (length=200) Species: 9606 (Homo sapiens) [Search protein sequence]
KPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGY
LHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGGKGAIDHYV
TPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLEKMRKD
QEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFYMPKRV
3D structure
PDB7pd3 Visualizing formation of the active site in the mitochondrial ribosome.
ChainN
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R63 R64 P66 K67 N68 R73 Y96 G100 H101 M104 K144 Q178 K182 K228 V229 S231 P232 Y233 R17 R18 P20 K21 N22 R27 Y50 G54 H55 M58 K93 Q127 K131 K177 V178 S180 P181 Y182
BS02 peptide N E168 E171 F175 E117 E120 F124
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pd3, PDBe:7pd3, PDBj:7pd3
PDBsum7pd3
PubMed34609277
UniProtQ9NX20|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]