Structure of PDB 7oj0 Chain N

Receptor sequence
>7oj0N (length=100) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB7oj0 Structural basis of l-tryptophan-dependent inhibition of release factor 2 by the TnaC arrest peptide.
ChainN
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N A2 K3 Q4 S5 A8 R9 R13 F21 R24 L48 R53 S56 S58 R59 R61 R63 T67 R69 P70 H71 G72 F73 R75 R81 R85 K98 S100 W101 A1 K2 Q3 S4 A7 R8 R12 F20 R23 L47 R52 S55 S57 R58 R60 R62 T66 R68 P69 H70 G71 F72 R74 R80 R84 K97 S99 W100
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oj0, PDBe:7oj0, PDBj:7oj0
PDBsum7oj0
PubMed34403461
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]