Structure of PDB 7of6 Chain N

Receptor sequence

>7of6N (length=205) Species: 9606 (Homo sapiens) [Search protein sequence]

KPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGY
LHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGA
IDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLE
KMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFY
MPKRV

3D structure

PDB

7of6 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	R63 R64 P66 K67 N68 L69 S70 R73 Y96 G100 H101 M104 R111 R133 K134 R139 M140 G141 G142 G143 K144 Q178 K182 L183 P184 R227 K228 V229 L230 S231 P232 Y233 K244	R17 R18 P20 K21 N22 L23 S24 R27 Y50 G54 H55 M58 R65 R87 K88 R93 M94 G95 G96 G97 K98 Q132 K136 L137 P138 R181 K182 V183 L184 S185 P186 Y187 K198
BS02	peptide	N	E168 E170 E171	E122 E124 E125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7of6, PDBe:7of6, PDBj:7of6
PDBsum	7of6
PubMed	34135319
UniProt	Q9NX20\|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]