Structure of PDB 7msz Chain N

Receptor sequence

>7mszN (length=116) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

PKPTKGPRLGGSSSHQKAILANLATSLFEHGRITTTEPKARALRPYAEKL
ITHAKKGALHNRREVLKKLRDKDVVHTLFAEIGPFFADRDGGYTRIIKIE
ARKGDNAPMAVIELVR

3D structure

PDB

7msz Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	P2 K3 P4 T5 K6 P8 R9 G12 S14 H16 N23 L24 I34 T35 T36 P39 R42 P46 E49 K50 T53 L60 H61 R63 R64 L67 K68 R71 K73 D74 H77 R90 D91 G92 G93 T95 R96 K99 R103 K104 G105 D106 N107 A108	P1 K2 P3 T4 K5 P7 R8 G11 S13 H15 N22 L23 I33 T34 T35 P38 R41 P45 E48 K49 T52 L59 H60 R62 R63 L66 K67 R70 K72 D73 H76 R89 D90 G91 G92 T94 R95 K98 R102 K103 G104 D105 N106 A107

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0009274	peptidoglycan-based cell wall
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7msz, PDBe:7msz, PDBj:7msz
PDBsum	7msz
PubMed	35064151
UniProt	P9WHD3\|RL17_MYCTU Large ribosomal subunit protein bL17 (Gene Name=rplQ)