Structure of PDB 7m4y Chain N

Receptor sequence
>7m4yN (length=114) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
EKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLAQA
STLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRI
KALADAAREGGLEF
3D structure
PDB7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
ChainN
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R11 S14 L17 H18 R93 Y98 F116 R9 S12 L15 H16 R91 Y96 F114
BS02 rna N K4 K5 R26 R31 T32 R34 H35 Y37 Q39 G45 G46 Q51 R60 N66 H99 R101 K2 K3 R24 R29 T30 R32 H33 Y35 Q37 G43 G44 Q49 R58 N64 H97 R99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
PDBsum7m4y
PubMed34044590
UniProtB7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]