Structure of PDB 7jss Chain N

Receptor sequence

>7jssN (length=127) Species: 83333 (Escherichia coli K-12)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 7jss ArfB can displace mRNA to rescue stalled ribosomes.
• Chain: N
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	Q4 Y6 R10 R11 K12 S13 A15 R17 R32 Y37 E41 K67 G68 G69 G70 S72 Q74 R98 T104 R105 A107 R108 V110 E111 R112 K113 K114 V115 G116 K119 R121 R122 R123 P124 Q125 F126 K128	Q2 Y4 R8 R9 K10 S11 A13 R15 R30 Y35 E39 K65 G66 G67 G68 S70 Q72 R96 T102 R103 A105 R106 V108 E109 R110 K111 K112 V113 G114 K117 R119 R120 R121 P122 Q123 F124 K126
BS02	rna	N	K128 R129	K126 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7jss, PDBe:7jss, PDBj:7jss
• PDBsum: 7jss
• PubMed: 33144582
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)