Structure of PDB 7et3 Chain N

Receptor sequence
>7et3N (length=65) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence]
AVFFEPHEENVLRCPERVLRRLLEDAAVTMRGGGWREDVLMDRVRKRYLR
QELRDLGHRVQTYCE
3D structure
PDB7et3 Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
ChainN
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide N K58 R62 R66 G69 V72 Q73 C76 K46 R50 R54 G57 V60 Q61 C64
BS02 peptide N L61 E64 L65 L68 R71 L49 E52 L53 L56 R59
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
GO:0019073 viral DNA genome packaging
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7et3, PDBe:7et3, PDBj:7et3
PDBsum7et3
PubMed34315863
UniProtP16726|CVC2_HCMVA Capsid vertex component 2 (Gene Name=CVC2)

[Back to BioLiP]