Structure of PDB 7aqc Chain N

Receptor sequence

>7aqcN (length=119) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVEKMITLG
KRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRI
MKLGPRRGDGAPMAIIELV

3D structure

• PDB: 7aqc Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
• Chain: N
• Resolution: 2.99 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	S2 Y3 R4 K5 G7 R8 S10 Q12 R13 K14 R18 L20 D23 I30 T32 T35 R36 K38 S42 E45 K46 T49 R53 L56 H57 R59 R60 Q61 A64 R67 Q81 R94 Q95 G96 G97 R100 K103 R107 R108 G109 D110 A112	S1 Y2 R3 K4 G6 R7 S9 Q11 R12 K13 R17 L19 D22 I29 T31 T34 R35 K37 S41 E44 K45 T48 R52 L55 H56 R58 R59 Q60 A63 R66 Q80 R93 Q94 G95 G96 R99 K102 R106 R107 G108 D109 A111

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7aqc, PDBe:7aqc, PDBj:7aqc
• PDBsum: 7aqc
• PubMed: 33259811
• UniProt: P20277|RL17_BACSU Large ribosomal subunit protein bL17 (Gene Name=rplQ)