Structure of PDB 6wdr Chain N

Receptor sequence
>6wdrN (length=150) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN
3D structure
PDB6wdr An open interface in the pre-80S ribosome coordinated by ribosome assembly factors Tsr1 and Dim1 enables temporal regulation of Fap7.
ChainN
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N G2 R3 H5 G8 G10 I11 S12 S14 P17 R55 T61 R64 K70 M72 R73 K94 H101 N105 K107 D108 F113 L117 S120 R121 R124 Y128 G1 R2 H4 G7 G9 I10 S11 S13 P16 R54 T60 R63 K69 M71 R72 K93 H100 N104 K106 D107 F112 L116 S119 R120 R123 Y127
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wdr, PDBe:6wdr, PDBj:6wdr
PDBsum6wdr
PubMed33219089
UniProtP05756|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)

[Back to BioLiP]