Structure of PDB 6wc5 Chain N

Receptor sequence
>6wc5N (length=55) Species: 9606 (Homo sapiens) [Search protein sequence]
KPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNR
RYKSK
3D structure
PDB6wc5 Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface.
ChainN
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna N K140 R142 Y162 R168 K183 Q187 R190 K1 R3 Y23 R29 K44 Q48 R51
BS02 dna N R142 F145 Q181 W185 N188 R3 F6 Q42 W46 N49
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6wc5, PDBe:6wc5, PDBj:6wc5
PDBsum6wc5
PubMed32681840
UniProtP52952|NKX25_HUMAN Homeobox protein Nkx-2.5 (Gene Name=NKX2-5)

[Back to BioLiP]