Structure of PDB 6v3d Chain N

Receptor sequence
>6v3dN (length=114) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
EKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLAQA
STLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRI
KALADAAREGGLEF
3D structure
PDB6v3d Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
ChainN
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R10 R11 K13 S14 L17 H18 R93 Y98 R110 F116 R8 R9 K11 S12 L15 H16 R91 Y96 R108 F114
BS02 rna N K4 K5 R16 R26 R31 T32 P33 R34 H35 Y37 V48 Q51 R60 N66 I67 K97 H99 G100 R101 K2 K3 R14 R24 R29 T30 P31 R32 H33 Y35 V46 Q49 R58 N64 I65 K95 H97 G98 R99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v3d, PDBe:6v3d, PDBj:6v3d
PDBsum6v3d
PubMed31964740
UniProtB7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]