Structure of PDB 6swd Chain N

Receptor sequence
>6swdN (length=146) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
PGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQAR
GIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHD
EVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR
3D structure
PDB6swd Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
ChainN
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N P2 G3 K4 K5 A6 N8 F11 R20 K21 F23 R29 K31 R32 R33 R36 A47 P48 Q49 R51 Q64 N66 S67 K71 E106 D118 E136 P1 G2 K3 K4 A5 N7 F10 R19 K20 F22 R28 K30 R31 R32 R35 A46 P47 Q48 R50 Q63 N65 S66 K70 E105 D117 E135
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swd, PDBe:6swd, PDBj:6swd
PDBsum6swd
PubMed32029867
UniProtP61994|RS12_PYRAB Small ribosomal subunit protein uS12 (Gene Name=rps12)

[Back to BioLiP]