Structure of PDB 6swa Chain N

Receptor sequence
>6swaN (length=195) Species: 10090 (Mus musculus) [Search protein sequence]
QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKY
LAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKV
LDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTA
TLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTN
3D structure
PDB6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
ChainN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
GO:0032496 response to lipopolysaccharide
GO:0042592 homeostatic process
GO:0048246 macrophage chemotaxis
GO:0060425 lung morphogenesis
GO:0071346 cellular response to type II interferon
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
GO:1901194 negative regulation of formation of translation preinitiation complex
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0097452 GAIT complex
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swa, PDBe:6swa, PDBj:6swa
PDBsum6swa
PubMed33357414
UniProtP19253|RL13A_MOUSE Large ribosomal subunit protein uL13 (Gene Name=Rpl13a)

[Back to BioLiP]