Structure of PDB 6ogg Chain N

Receptor sequence

>6oggN (length=127) Species: 562 (Escherichia coli)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 6ogg Extensive ribosome and RF2 rearrangements during translation termination.
• Chain: N
• Resolution: 4.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	Q4 Y6 R10 K12 S13 A15 A16 R17 R40 E41 Y63 G69 G70 I71 S72 Q74 R84 R98 T104 R108 Q109 V110 E111 R112 K113 K114 V115 R118 R121 R123 P124 Q125 F126 S127 K128	Q2 Y4 R8 K10 S11 A13 A14 R15 R38 E39 Y61 G67 G68 I69 S70 Q72 R82 R96 T102 R106 Q107 V108 E109 R110 K111 K112 V113 R116 R119 R121 P122 Q123 F124 S125 K126

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ogg, PDBe:6ogg, PDBj:6ogg
• PDBsum: 6ogg
• PubMed: 31513010
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)