Structure of PDB 6ocp Chain N |
>6ocpN (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] |
FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSLAKDSKGRFFIDRDGF LFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLT |
|
PDB | 6ocp Structural basis for auxiliary subunit KCTD16 regulation of the GABABreceptor. |
Chain | N |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
N |
Q34 F80 |
Q12 F50 |
|
|
|
|