Structure of PDB 6nu2 Chain N

Receptor sequence

>6nu2N (length=205) Species: 9606 (Homo sapiens) [Search protein sequence]

KPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGY
LHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGA
IDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLE
KMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFY
MPKRV

3D structure

PDB

6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	R63 P66 K67 R73 Y96 H101 M104 R111 K116 T132 R133 K134 V136 R139 M140 G141 G143 K144 Q178 K182 P184 R227 K228 V229 S231 P232 K244	R17 P20 K21 R27 Y50 H55 M58 R65 K70 T86 R87 K88 V90 R93 M94 G95 G97 K98 Q132 K136 P138 R181 K182 V183 S185 P186 K198
BS02	peptide	N	E168 E170 E171	E122 E124 E125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum	6nu2
PubMed	30962385
UniProt	Q9NX20\|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]