Structure of PDB 6neq Chain N

Receptor sequence
>6neqN (length=101) Species: 9913 (Bos taurus) [Search protein sequence]
YYVDWRMLRDVKRRKMAYEYADERLRINSLRKNTILPKHLQEVADEEIAA
LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAI
W
3D structure
PDB6neq Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
ChainN
Resolution3.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N Y28 W32 L35 R36 R40 R51 N55 R58 K59 I75 R80 C83 V85 R86 R88 N89 T94 R96 R98 G99 R102 R108 I109 R112 I127 W128 Y1 W5 L8 R9 R13 R24 N28 R31 K32 I48 R53 C56 V58 R59 R61 N62 T67 R69 R71 G72 R75 R81 I82 R85 I100 W101
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6neq, PDBe:6neq, PDBj:6neq
PDBsum6neq
PubMed30677741
UniProtQ6B860|RT14_BOVIN Small ribosomal subunit protein uS14m (Gene Name=MRPS14)

[Back to BioLiP]