Structure of PDB 6id0 Chain N

Receptor sequence

>6id0N (length=143) Species: 9606 (Homo sapiens) [Search protein sequence]

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS

3D structure

PDB

6id0 Structures of the human spliceosomes before and after release of the ligated exon.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	N	K91 K93	K91 K93
BS02	rna	N	R41 K42 Q95 G96 E98 N99 T111 N112 T115 N116 C117 I118 R120 V121 P122 L126 T135 H136 S143	R41 K42 Q95 G96 E98 N99 T111 N112 T115 N116 C117 I118 R120 V121 P122 L126 T135 H136 S143
BS03	ZN	N	C105 C117 C119 C134	C105 C117 C119 C134
BS04	ZN	N	C101 C102 C105 C137	C101 C102 C105 C137

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0016922	nuclear receptor binding
GO:0030374	nuclear receptor coactivator activity

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0045893	positive regulation of DNA-templated transcription
GO:2000825	positive regulation of androgen receptor activity

	Cellular Component
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0071007	U2-type catalytic step 2 spliceosome

External links

PDB	RCSB:6id0, PDBe:6id0, PDBj:6id0
PDBsum	6id0
PubMed	30728453
UniProt	P41223\|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)