Structure of PDB 6c6u Chain N

Receptor sequence
>6c6uN (length=98) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
KKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEKFFPGYV
LVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQ
3D structure
PDB6c6u Structural Basis for Transcript Elongation Control by NusG Family Universal Regulators.
ChainN
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna N F15 S16 F10 S11
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c6u, PDBe:6c6u, PDBj:6c6u
PDBsum6c6u
PubMed29887376
UniProtP0AFG0|NUSG_ECOLI Transcription termination/antitermination protein NusG (Gene Name=nusG)

[Back to BioLiP]