Structure of PDB 6bgn Chain N |
>6bgnN (length=59) Species: 303 (Pseudomonas putida) [Search protein sequence] |
PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHF GIGGELASK |
|
PDB | 6bgn Inactivation of 4-Oxalocrotonate Tautomerase by 5-Halo-2-hydroxy-2,4-pentadienoates. |
Chain | N |
Resolution | 1.51 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
P1 R39 F50 |
Catalytic site (residue number reindexed from 1) |
P1 R39 F50 |
Enzyme Commision number |
5.3.2.6: 2-hydroxymuconate tautomerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6Y5 |
N |
F50 I52 |
F50 I52 |
|
BS02 |
6Y5 |
N |
P1 S37 |
P1 S37 |
|
|
|
|