Structure of PDB 5zeb Chain N

Receptor sequence

>5zebN (length=134) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

MLIPRKVKHRKQHHPEQRGIASGGTSVSFGDYGIQALEHAYITNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPDEKTARDALTRAIHKLPIKARIVTR

3D structure

• PDB: 5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
• Chain: N
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	R5 K6 K8 H9 K11 H13 H14 E16 Q17 R18 S22 G24 F29 Y41 R45 Q46 S49 R56 R60 K63 W65 F69 R72 K76 K77 R82 M83 G84 S85 G86 K87 R101 R120 H123 K124 P126 K128	R5 K6 K8 H9 K11 H13 H14 E16 Q17 R18 S22 G24 F29 Y41 R45 Q46 S49 R56 R60 K63 W65 F69 R72 K76 K77 R82 M83 G84 S85 G86 K87 R101 R120 H123 K124 P126 K128

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
• PDBsum: 5zeb
• PubMed: 30206241
• UniProt: A0QSD8|RL16_MYCS2 Large ribosomal subunit protein uL16 (Gene Name=rplP)