Structure of PDB 5yzg Chain N

Receptor sequence

>5yzgN (length=143) Species: 9606 (Homo sapiens) [Search protein sequence]

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS

3D structure

PDB

5yzg Structure of a human catalytic step I spliceosome

Chain

Resolution

4.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	N	G39 R41 K42 Q95 E98 N99 T111 N112 T115 N116 C117 I118 R120 V121 P122 K125 L126 T135 H136 S143	G39 R41 K42 Q95 E98 N99 T111 N112 T115 N116 C117 I118 R120 V121 P122 K125 L126 T135 H136 S143
BS02	ZN	N	C105 C119 C134	C105 C119 C134
BS03	ZN	N	C101 C102 C137	C101 C102 C137
BS04	ZN	N	C119 C139	C119 C139

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0016922	nuclear receptor binding
GO:0030374	nuclear receptor coactivator activity

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0045893	positive regulation of DNA-templated transcription
GO:2000825	positive regulation of androgen receptor activity

	Cellular Component
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0071007	U2-type catalytic step 2 spliceosome

External links

PDB	RCSB:5yzg, PDBe:5yzg, PDBj:5yzg
PDBsum	5yzg
PubMed	29301961
UniProt	P41223\|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)