Structure of PDB 5xvo Chain N

Receptor sequence
>5xvoN (length=105) Species: 749498 (Enterococcus faecalis TX0027) [Search protein sequence]
RYMRLLLMFDMPTDTASDRKAYRKFRKFLINEGFIMHQFSVYSKILLNDT
ANKAMLARLKQNNPQRGLITLLNVTEKQFSRMIYLHGEQDNRVANSDERI
VFLGE
3D structure
PDB5xvo How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.
ChainN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna N F12 D13 M14 T16 Y25 R29 M39 F42 S43 Y45 F9 D10 M11 T13 Y22 R26 M36 F39 S40 Y42
BS02 dna N K23 R26 F42 K20 R23 F39
BS03 dna N T78 K80 R84 T75 K77 R81
BS04 MG N F12 D13 S43 F9 D10 S40
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 02:49:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xvo', asym_id = 'N', title = 'How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xvo', asym_id='N', title='How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004521,0043571', uniprot = '', pdbid = '5xvo', asym_id = 'N'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004521,0043571', uniprot='', pdbid='5xvo', asym_id='N')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>