Structure of PDB 5v7q Chain N

Receptor sequence

>5v7qN (length=116) Species: 1773 (Mycobacterium tuberculosis)

PKPTKGPRLGGSSSHQKAILANLATSLFEHGRITTTEPKARALRPYAEKL
ITHAKKGALHNRREVLKKLRDKDVVHTLFAEIGPFFADRDGGYTRIIKIE
ARKGDNAPMAVIELVR

3D structure

• PDB: 5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
• Chain: N
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	P2 K3 P4 K6 G7 P8 R9 S14 H16 L21 N23 L24 S27 H31 T35 T36 P39 K40 R42 R45 E49 K50 L60 H61 R63 R64 K68 R71 K73 H77 G92 G93 K99 R103 K104 D106 N107	P1 K2 P3 K5 G6 P7 R8 S13 H15 L20 N22 L23 S26 H30 T34 T35 P38 K39 R41 R44 E48 K49 L59 H60 R62 R63 K67 R70 K72 H76 G91 G92 K98 R102 K103 D105 N106

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
• PDBsum: 5v7q
• PubMed: 28977617
• UniProt: P9WHD3|RL17_MYCTU Large ribosomal subunit protein bL17 (Gene Name=rplQ)