Structure of PDB 5oql Chain N

Receptor sequence

>5oqlN (length=443) Species: 759272 (Thermochaetoides thermophila DSM 1495)

AEKDAEEEELEKFVLGAKETFREQLFRPAWEDSDDERLTISLAGATRLRK
LRISESEDLVSGIEYARRLRQQYLRLYPQPDWAKPLPLDSFLRDANSFKV
KLRPETIDIQRTRDIPDTHKAAISSLAFHPRYPILLSSSTSSIMYLHKLD
ASAYPTPNPLLTSVHVKRTDLRRAAFVGPDGGEIIFAGRRRYFHCWNLSS
GLVKKVSKIQGHQKEQRTMERFRVSPCGRYMALVASDKKGGGMLNIINVG
TMQWIAQARIDGRHGVADFAWWSDGNGLTIAGRDGQVTEWSMITRRTVGI
WRDEGSIGGTVMALGGRNGPAELGGDRWVAIGSNSGILNVYDRNDLIEIR
IKKYPTPTRVFEQLTTSISVVAFSPDGQLLAFGSQHKKDALRLVHLPSCT
VYRNWPTEQTPLGRVTAIAFSSKSDVLAVGNDVGRVRLWEIRG

3D structure

• PDB: 5oql 3.2- angstrom -resolution structure of the 90S preribosome before A1 pre-rRNA cleavage.
• Chain: N
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	T152 R153 R155 K156 Q178 I263 Q264 R322 R343 R344 R345 Y346 K359 S361 K362 Q367 R371 T372 R375 K392 K393 R417 H418 R437 N488 S542 Q560 H561 K563 D564 N579 T582 E583 Q584 T585 P586 R589	T46 R47 R49 K50 Q72 I109 Q110 R168 R189 R190 R191 Y192 K205 S207 K208 Q213 R217 T218 R221 K238 K239 R263 H264 R283 N334 S367 Q385 H386 K388 D389 N404 T407 E408 Q409 T410 P411 R414
BS02	rna	N	Q538 R567 R578 E583	Q363 R392 R403 E408

Gene Ontology

Biological Process

• GO:0006364 rRNA processing

Cellular Component

• GO:0005730 nucleolus
• GO:0032040 small-subunit processome
• GO:0034388 Pwp2p-containing subcomplex of 90S preribosome

External links

• PDB: RCSB:5oql, PDBe:5oql, PDBj:5oql
• PDBsum: 5oql
• PubMed: 28967883
• UniProt: G0SBN9