Structure of PDB 5nwl Chain N

Receptor sequence

>5nwlN (length=301) Species: 9606 (Homo sapiens) [Search protein sequence]

GPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK
ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER
LLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLI
VDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVV
GNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAK
D

3D structure

PDB

5nwl Two distinct conformational states define the interaction of human RAD51-ATP with single-stranded DNA.

Chain

Resolution

3.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	N	R130 G132 K133 T134 Q135 R170 Q268 R310 I329 N330	R110 G112 K113 T114 Q115 R150 Q248 R272 I291 N292

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0000166	nucleotide binding
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0003690	double-stranded DNA binding
GO:0003697	single-stranded DNA binding
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008094	ATP-dependent activity, acting on DNA
GO:0016887	ATP hydrolysis activity
GO:0017116	single-stranded DNA helicase activity
GO:0019899	enzyme binding
GO:0042802	identical protein binding
GO:0070182	DNA polymerase binding
GO:0140664	ATP-dependent DNA damage sensor activity

	Biological Process
GO:0000722	telomere maintenance via recombination
GO:0000724	double-strand break repair via homologous recombination
GO:0000730	DNA recombinase assembly
GO:0006259	DNA metabolic process
GO:0006268	DNA unwinding involved in DNA replication
GO:0006281	DNA repair
GO:0006310	DNA recombination
GO:0006312	mitotic recombination
GO:0006974	DNA damage response
GO:0007131	reciprocal meiotic recombination
GO:0010569	regulation of double-strand break repair via homologous recombination
GO:0010833	telomere maintenance via telomere lengthening
GO:0031297	replication fork processing
GO:0032200	telomere organization
GO:0036297	interstrand cross-link repair
GO:0042148	DNA strand invasion
GO:0051106	positive regulation of DNA ligation
GO:0051321	meiotic cell cycle
GO:0070192	chromosome organization involved in meiotic cell cycle
GO:0071312	cellular response to alkaloid
GO:0071479	cellular response to ionizing radiation
GO:0072711	cellular response to hydroxyurea
GO:0072757	cellular response to camptothecin
GO:1990414	replication-born double-strand break repair via sister chromatid exchange
GO:1990426	mitotic recombination-dependent replication fork processing
GO:1990918	double-strand break repair involved in meiotic recombination
GO:2000001	regulation of DNA damage checkpoint

	Cellular Component
GO:0000152	nuclear ubiquitin ligase complex
GO:0000228	nuclear chromosome
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0000793	condensed chromosome
GO:0000794	condensed nuclear chromosome
GO:0000800	lateral element
GO:0001673	male germ cell nucleus
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0016605	PML body
GO:0032991	protein-containing complex
GO:0035861	site of double-strand break
GO:0048471	perinuclear region of cytoplasm
GO:0099182	presynaptic intermediate filament cytoskeleton

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nwl, PDBe:5nwl, PDBj:5nwl
PDBsum	5nwl
PubMed	29507080
UniProt	Q06609\|RAD51_HUMAN DNA repair protein RAD51 homolog 1 (Gene Name=RAD51)

[Back to BioLiP]