Structure of PDB 5no4 Chain N

Receptor sequence
>5no4N (length=100) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB5no4 RsgA couples the maturation state of the 30S ribosomal decoding center to activation of its GTPase pocket.
ChainN
Resolution5.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N A2 K3 S5 M6 R9 R13 D33 R53 S58 R59 R61 R63 R69 H71 G72 R75 R81 I82 S100 W101 A1 K2 S4 M5 R8 R12 D32 R52 S57 R58 R60 R62 R68 H70 G71 R74 R80 I81 S99 W100
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5no4, PDBe:5no4, PDBj:5no4
PDBsum5no4
PubMed28482099
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]