Structure of PDB 5jbh Chain N

Receptor sequence

>5jbhN (length=145) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]

GKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARG
IVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDE
VIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR

3D structure

PDB

5jbh Cryo-EM study of start codon selection during archaeal translation initiation.

Chain

Resolution

5.34 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	G3 K5 P7 N8 G9 E10 R14 R20 K21 F23 R24 S26 Y30 K31 R32 R33 R36 P48 Q49 A50 R51 V60 E61 Q64 P65 G68 M69 I78 K79 G90 D91 E106 G107 I108 G109 G110 P111 D118 P120 G121 R123 R131 S133 K135 K142	G1 K3 P5 N6 G7 E8 R12 R18 K19 F21 R22 S24 Y28 K29 R30 R31 R34 P46 Q47 A48 R49 V58 E59 Q62 P63 G66 M67 I76 K77 G88 D89 E104 G105 I106 G107 G108 P109 D116 P118 G119 R121 R129 S131 K133 K140

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum	5jbh
PubMed	27819266
UniProt	P61994\|RS12_PYRAB Small ribosomal subunit protein uS12 (Gene Name=rps12)