Structure of PDB 5iya Chain N |
>5iyaN (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMGQVEEEP LNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGR DYIFSKAIGDAEW |
|
PDB | 5iya Near-atomic resolution visualization of human transcription promoter opening. |
Chain | N |
Resolution | 5.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
N |
R344 K346 |
R81 K83 |
|
|
|
|