Structure of PDB 4x62 Chain N

Receptor sequence
>4x62N (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB4x62 N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
ChainN
Resolution3.4492 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N A2 R3 K4 A5 F16 V18 R19 Y21 T22 C27 R29 R31 S32 Y34 R35 R41 I42 R45 E46 K58 S60 W61 A1 R2 K3 A4 F15 V17 R18 Y20 T21 C26 R28 R30 S31 Y33 R34 R40 I41 R44 E45 K57 S59 W60
BS02 ZN N C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4x62, PDBe:4x62, PDBj:4x62
PDBsum4x62
PubMed26751643
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]