Structure of PDB 4wfn Chain N

Receptor sequence

>4wfnN (length=117) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRR
NKKRDFRRLWIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAR
EPEAFKALVDASRNARQ

3D structure

• PDB: 4wfn The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
• Chain: N
• Resolution: 3.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	P2 R3 A4 K5 T6 I8 R10 R11 R13 H14 K15 K16 K19 K22 G23 F24 W25 G26 S27 R28 S29 Q31 Y32 R33 Q37 N41 A42 Y45 Y47 R48 D49 R50 R51 K53 K54 R55 F57 R59 W61 I62 Q63 N66 R70 N75 Y76 S77 N81 K84 R85 K93	P1 R2 A3 K4 T5 I7 R9 R10 R12 H13 K14 K15 K18 K21 G22 F23 W24 G25 S26 R27 S28 Q30 Y31 R32 Q36 N40 A41 Y44 Y46 R47 D48 R49 R50 K52 K53 R54 F56 R58 W60 I61 Q62 N65 R69 N74 Y75 S76 N80 K83 R84 K92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wfn, PDBe:4wfn, PDBj:4wfn
• PDBsum: 4wfn
• PubMed: 28689968
• UniProt: Q9RSW7|RL20_DEIRA Large ribosomal subunit protein bL20 (Gene Name=rplT)