Structure of PDB 4v19 Chain N

Receptor sequence

>4v19N (length=177) Species: 9823 (Sus scrofa)

SSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQLS
DCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDPV
AIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKV
PRRLDEYTQEEIEAFPRVWSPPEDYRL

3D structure

• PDB: 4v19 The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
• Chain: N
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	G29 K30 Q49 L50 S68 K71 K75 Y77 S78 H80 P84 G85 F87 R88 K98 A107 G110 M111 K114 N115 L116 H117 R118 R119 Y176 R177	G28 K29 Q48 L49 S67 K70 K74 Y76 S77 H79 P83 G84 F86 R87 K97 A106 G109 M110 K113 N114 L115 H116 R117 R118 Y175 R176

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 09:09:35 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v19', asym_id = 'N', title = 'The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v19', asym_id='N', title='The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v19', asym_id = 'N'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v19', asym_id='N')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>