Structure of PDB 4v0u Chain N

Receptor sequence

>4v0uN (length=294) Species: 10090 (Mus musculus) [Search protein sequence]

LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELE
APLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICL
LLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCF
NCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLW
SDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
FFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE

3D structure

PDB

4v0u G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.

Chain

Resolution

7.88 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D64 H66 D92 D95 R96 N124 H125 H173 R221 H248
Catalytic site (residue number reindexed from 1)	D58 H60 D86 D89 R90 N118 H119 H167 R215 H242
Enzyme Commision number	3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	N	Q68 D71 R74 Y78 D242 F257 P270 N271 D277 E287 L289 M290 C291 S292 F293 Q294 I295 L296 K297 P298 A299 E300	Q62 D65 R68 Y72 D236 F251 P264 N265 D271 E281 L283 M284 C285 S286 F287 Q288 I289 L290 K291 P292 A293 E294
BS02	MN	N	D64 H66 D92	D58 H60 D86
BS03	MN	N	D92 N124 H173 H248	D86 N118 H167 H242

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0005515	protein binding
GO:0005521	lamin binding
GO:0008157	protein phosphatase 1 binding
GO:0016787	hydrolase activity
GO:0016791	phosphatase activity
GO:0017018	myosin phosphatase activity
GO:0019901	protein kinase binding
GO:0019903	protein phosphatase binding
GO:0019904	protein domain specific binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0001824	blastocyst development
GO:0005977	glycogen metabolic process
GO:0006470	protein dephosphorylation
GO:0007283	spermatogenesis
GO:0030182	neuron differentiation
GO:0032922	circadian regulation of gene expression
GO:0042752	regulation of circadian rhythm
GO:0043153	entrainment of circadian clock by photoperiod
GO:0046822	regulation of nucleocytoplasmic transport
GO:0048511	rhythmic process
GO:0051301	cell division
GO:0060252	positive regulation of glial cell proliferation

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005741	mitochondrial outer membrane
GO:0005815	microtubule organizing center
GO:0005856	cytoskeleton
GO:0016607	nuclear speck
GO:0030496	midbody
GO:0032154	cleavage furrow
GO:0032991	protein-containing complex
GO:0043197	dendritic spine
GO:0072357	PTW/PP1 phosphatase complex
GO:0098793	presynapse
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v0u, PDBe:4v0u, PDBj:4v0u
PDBsum	4v0u
PubMed	25774600
UniProt	P63087\|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (Gene Name=Ppp1cc)

[Back to BioLiP]