Structure of PDB 4qiw Chain N

Receptor sequence

>4qiwN (length=63) Species: 69014 (Thermococcus kodakarensis KOD1)

MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLL
SHVELIDQVMVYK

3D structure

• PDB: 4qiw The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
• Chain: N
• Resolution: 3.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	N	C10 C44 C45	C10 C44 C45

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005694 chromosome
• GO:0005737 cytoplasm

External links

• PDB: RCSB:4qiw, PDBe:4qiw, PDBj:4qiw
• PDBsum: 4qiw
• PubMed: 25311937
• UniProt: Q5JJC9|RPO10_THEKO DNA-directed RNA polymerase subunit Rpo10 (Gene Name=rpo10)